Avatar
The Fockin’ Fury
a76dc09a8c2437c08d918d0896c6a10cc22a5ea74339a0925175dadce1c9508f
Web2 product guy since 2011. Bitcoin holder since 2017. Node runner since 2020. Recovering NFT degenerate since 2022. Relayer since 2023.

Did it work? Someone just paid it lol, might have been you. Here’s a zap anyways.

Figured. Here’s a zap anyway! ⚡️

Testing something. Is someone able to pay this 2 sat invoice? Lmk if you get an error or it if works. Will zap back 20X! #asknostr

lnbc20n1pn34k4tsp5ra0ds4mpx9ck3h77jc0eecdapy90gkte99r5qqtc59shln798n2qpp5x2per7pmsn87694nuz9wuzdgpcaxc7x8250clryks9d0f8ms8l7qdq823jhxaqxqyjw5qcqpjrzjqf0zuplwpzhn6hymqjhcfcylzxqhtx5vc64xgac40nnr8sfqaveqmapyqqqqqqqqqyqqqqlgqqqqqqgq2q9qxpqysgqhuh8r2z8n5qjeu6dnqx3zm6nurx5ej380uuz0rz4l7zspx4rt03hpk2vvpd8djnukd3eqg7upjexjf45yddlf56tzpa9phll2sctewgq424t0v

Rewind in history, the CIA armed the Taliban because they were fighting Soviet occupation in Afghanistan and the US we trying to keep communism in check at all costs. And then a few short decades later… oopsies, 9/11!

Replying to Avatar The Bird

Now do the Taliban!

You literally just ignored his entire point and made a trite, bad-faith argument that amounts to “reeee I read on the internet that progressives don’t really want progress for *everyone*”

Conservatives once again prove to be at least 10x better at memesmithery than liberals

Replying to Avatar ew0k

Alien-human hybridization programs for the purpose of colonizing and/or (if they’re coming from the future) directing us to their biological state makes some sense to me. It would explain why they might kidnap people and gestate hybrids for some time in the woman before taking the embryo back and into some other incubator (or leaving it if it’s viable to term).

What I find harder to believe is the claim that aliens are “only” taking DNA samples to help diversify their own population because they’re dying out and want to become more fertile.

We have 1,000s of people’s genomes sequenced already, can’t they just take the info and synthesize the DNA chemically? We can already make synthetic cells and program simple genetic circuits*— how can engineering themselves to be more fertile be beyond their technology (even without human DNA input) if they are millions of years ahead of us?

Is it possible they’re actually quite dumb and just inherited fast spaceships? Did they live through an era of Idiocracy? Should we be even more concerned about interacting with these folks than we are right now???

* (It is possible there is more to DNA samples than just sequence, eg epigenetic markers, bound protein factors, or other things not known to us, or the claim of “taking DNA samples” is a hyper simplistic term lost in translation that stands for some other process, or hybridization biology between two perhaps entirely unrelated species is much harder than I’d expect.)

#NHI #UAP

1. What

When NWC works it’s pretty dope

As a liberal I need to hand it to you guys. Conservative memes have always been spicier.

Let me give it a shot too: It’s a cartoon duck wearing a hat and sunglasses and smoking a cigarette. I paid the equivalent of $300 for it and now it’s not even worth its face value because literally nobody is buying NFTs anymore.

Didn’t say they were good learnings lol. Just…learnings

A cause we can all get behind on some level