What do you do in a full 16 hour flight?

Mai suggest making these “hashtag vs. search terms” more like tabs?

dfdf

beautiful shots, enjoy it buddy 💜

Elon probably feeling pretty dumb for selling

Nostr can’t be bought … can it? DAFUQ

Imagine having that much money just for a domain, I could use that to pay all of my current contributors for a few years… instead I am just losing contributors slowly due to lack of funding and denied grants. Sigh.

Testing something. Is someone able to pay this 2 sat invoice? Lmk if you get an error or it if works. Will zap back 20X! #asknostr

lnbc20n1pn34k4tsp5ra0ds4mpx9ck3h77jc0eecdapy90gkte99r5qqtc59shln798n2qpp5x2per7pmsn87694nuz9wuzdgpcaxc7x8250clryks9d0f8ms8l7qdq823jhxaqxqyjw5qcqpjrzjqf0zuplwpzhn6hymqjhcfcylzxqhtx5vc64xgac40nnr8sfqaveqmapyqqqqqqqqqyqqqqlgqqqqqqgq2q9qxpqysgqhuh8r2z8n5qjeu6dnqx3zm6nurx5ej380uuz0rz4l7zspx4rt03hpk2vvpd8djnukd3eqg7upjexjf45yddlf56tzpa9phll2sctewgq424t0v

Ability to have multiple accounts would be amazing. Use case: I have two nsec’s I use for different subject matter. One is all bitcoin related, the other is my photography. Very different topics I like to keep separate. Right now I either use two different apps (Damus being one) for each, or I have to log out and re-enter the nsec every time I want to switch. FWIW Primal has this feature and it is very convenient. But I’d rather use Damus.